PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_24798A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 391aa    MW: 42695.4 Da    PI: 9.0513
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_24798AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.65e-442473461100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +Ca+Ck+lrr+C+++Cv+apyfp e+p++fa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq
  Oropetium_20150105_24798A 247 PCASCKLLRRRCTQECVFAPYFPPEDPHRFAIVHKVFGASNVSKMLQELPVHQRADAVSSLVYEANARLRDPVYGCVGAISYLQ 330
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                qq++ql+ +lal+k+e
  Oropetium_20150105_24798A 331 QQVSQLQMQLALAKAE 346
                                ************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.37246347IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-43247344IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MPAPGEHLPD HTLSFFASTL SHQRHLAARM FGDDGLRLLQ IALSAGADVP GMLATRSSAR  60
RLLRARAAEA FRQAPGGVQD HSRSLSVADF FARAFALVGD VESCLAMRYE ALLLRDAKYS  120
NNLQLQVSRE ELLTFAKDSL DNGFYAIASK AFTNAIACLR PSQRRHSGPT NSTAEKEKIN  180
HISGLQKLAM SLSAQHSVQM QSAEYMKRRA LDVHADSLLV AQSSTRPWIK SMAGSGSSGN  240
SPSSVPPCAS CKLLRRRCTQ ECVFAPYFPP EDPHRFAIVH KVFGASNVSK MLQELPVHQR  300
ADAVSSLVYE ANARLRDPVY GCVGAISYLQ QQVSQLQMQL ALAKAEIRCV QMQQHDDGGQ  360
NNYGHYSTAA APSSKQQQVQ QHMDGETILS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1008522e-97FP100852.1 Phyllostachys edulis cDNA clone: bphyst013p01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448863.12e-82hypothetical protein SORBIDRAFT_05g000540
TrEMBLA0A0E0MIP51e-132A0A0E0MIP5_ORYPU; Uncharacterized protein
STRINGSb05g000540.17e-82(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP675133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.17e-56LBD family protein